Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACAA1 protein

This Human ACAA1 protein spans the amino acid sequence from region 27-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACAA1

UniProt

P09110

Expression Region

27-331aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-tag and expression region is 27-331aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEIL1 (NM_024608) Human Recombinant Protein
TP302329M 100 µg

NEIL1 (NM_024608) Human Recombinant Protein

Sign In for Pricing
View Details
FAM71B Double Nickase Plasmid (h)
sc-408021-NIC 20 µg

FAM71B Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Anti-POMGNT1 Antibody Picoband®, HRP Conjugate
A03489-1-HRP 100 µg/Vial

Anti-POMGNT1 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Recombinant Human ZNF175 Protein - (Dry Ice)
H00007728-P01-10ug 10 µg

Recombinant Human ZNF175 Protein - (Dry Ice)

Sign In for Pricing
View Details
KRTAP5-1 siRNA Oligos set (Human)
26194171 3x 5 nmol

KRTAP5-1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Olr1533 (NM_001000496) Rat Tagged Lenti ORF Clone
RR205707L4 10 µg

Olr1533 (NM_001000496) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details