Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACAA1 protein

This Human ACAA1 protein spans the amino acid sequence from region 27-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACAA1

UniProt

P09110

Expression Region

27-331aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-tag and expression region is 27-331aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcobalamin II siRNA (h)
sc-45320 10 µM

Transcobalamin II siRNA (h)

Sign In for Pricing
View Details
Pulmonary surfactant-associated protein C
AP79147-01 50 µg

Pulmonary surfactant-associated protein C

Sign In for Pricing
View Details
Pulmonary surfactant-associated protein C
AP79147-02 100 µg

Pulmonary surfactant-associated protein C

Sign In for Pricing
View Details
Pulmonary surfactant-associated protein C
AP79147-03 1 mg

Pulmonary surfactant-associated protein C

Sign In for Pricing
View Details
Rat Akap5 Pre-designed siRNA Set B
SI200466B 1 Each

Rat Akap5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
VCX Rabbit Polyclonal Antibody
orb1880907-01 30 µL

VCX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details