Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast pburs protein

This Yeast pburs protein spans the amino acid sequence from region 21-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pburs

UniProt

Q9VJS7

Expression Region

21-141aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC10 Protein Vector (Mouse) (pPB-N-His)
PV197535 500 ng

LRRC10 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Testosterone ELISA Kit
PT872 96 Tests

Testosterone ELISA Kit

Sign In for Pricing
View Details
CTSD (Cathepsin D, CPSD) (MaxLight 490)
MBS6200341-01 0.1 mL

CTSD (Cathepsin D, CPSD) (MaxLight 490)

Sign In for Pricing
View Details
CTSD (Cathepsin D, CPSD) (MaxLight 490)
MBS6200341-02 5x 0.1 mL

CTSD (Cathepsin D, CPSD) (MaxLight 490)

Sign In for Pricing
View Details
Anti-Human CD301/CLEC10A Monoclonal Antibody (49C11), PerCP
PTX23369 100 µg

Anti-Human CD301/CLEC10A Monoclonal Antibody (49C11), PerCP

Sign In for Pricing
View Details
SEN1 Antibody
orb1332964 100 µg

SEN1 Antibody

Sign In for Pricing
View Details