Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLL3 protein

This Human DLL3 protein spans the amino acid sequence from region 27-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLL3 protein

UniProt

Q9NYJ7

Expression Region

27-492aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoo ORF Vector (Mouse) (pORF)
ORF038850 1.0 µg DNA

Apoo ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
IGSF4B shRNA Plasmid (h)
sc-88048-SH 20 µg

IGSF4B shRNA Plasmid (h)

Sign In for Pricing
View Details
Hsa-miR-20a-5p miRNA Antagomir
orb1916296-01 10 nmol

Hsa-miR-20a-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-20a-5p miRNA Antagomir
orb1916296-02 20 nmol

Hsa-miR-20a-5p miRNA Antagomir

Sign In for Pricing
View Details
Fam149a siRNA Oligos set (Mouse)
19785174 3x 5 nmol

Fam149a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
4-Isocyanatopyridine discontinued
432882-01 1 g

4-Isocyanatopyridine discontinued

Sign In for Pricing
View Details