Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLL3 protein

This Human DLL3 protein spans the amino acid sequence from region 27-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLL3 protein

UniProt

Q9NYJ7

Expression Region

27-492aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-HER2  (Tyr1112)  Antibody
ABF3071 100 µg

Phospho-HER2 (Tyr1112) Antibody

Sign In for Pricing
View Details
Lentiviral human VWA7 sgRNA gene knockout kit - Lentiviral human VWA7 sgRNA gene knockout kit (plasmid)
GTR15367184 1 Vial

Lentiviral human VWA7 sgRNA gene knockout kit - Lentiviral human VWA7 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
2-Diethylaminoethyl hexanoate citric acid salt
FD163628 1000 mg

2-Diethylaminoethyl hexanoate citric acid salt

Sign In for Pricing
View Details
CSF2RA Antibody - C-terminal region (ARP64561_P050)
ARP64561_P050 100 µL

CSF2RA Antibody - C-terminal region (ARP64561_P050)

Sign In for Pricing
View Details
RCL Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-7827R-BF647 100 µL

RCL Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Id2 (NM_013060) Rat Untagged Clone
RN207985 10 µg

Id2 (NM_013060) Rat Untagged Clone

Sign In for Pricing
View Details