Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLL3 protein

This Human DLL3 protein spans the amino acid sequence from region 27-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLL3 protein

UniProt

Q9NYJ7

Expression Region

27-492aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl24 (NM_019577) Mouse Tagged ORF Clone
MR200566 10 µg

Ccl24 (NM_019577) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Mouse CD73 (TY/23) In Vivo Antibody - Low Endotoxin
ICH1231-100mg 100 mg

Anti-Mouse CD73 (TY/23) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Mouse APE Matched Antibody Pair Set [ABP-S-02163]
ABP-S-02163 5 Plates

Mouse APE Matched Antibody Pair Set [ABP-S-02163]

Sign In for Pricing
View Details
Bovine Activin A, ACV ELISA Kit
QY-E60004 96 Tests

Bovine Activin A, ACV ELISA Kit

Sign In for Pricing
View Details
IREB2, ID (IREB2, Iron-responsive element-binding protein 2, Iron regulatory protein 2) (APC) discontinued
037099-APC 200 µL

IREB2, ID (IREB2, Iron-responsive element-binding protein 2, Iron regulatory protein 2) (APC) discontinued

Sign In for Pricing
View Details
TBC1D3C CRISPR Activation Plasmid (h2)
sc-416411-ACT-2 20 µg

TBC1D3C CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details