Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G12A protein

This Human PLA2G12A protein spans the amino acid sequence from region 23-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2G12A

UniProt

Q9BZM1

Expression Region

23-185aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CETP Recombinant Protein (Human)
RP006847 100 µg

CETP Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit
MBS9335545-01 48 Well

Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit

Sign In for Pricing
View Details
Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit
MBS9335545-02 96 Well

Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit

Sign In for Pricing
View Details
Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit
MBS9335545-03 5x 96 Well

Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit

Sign In for Pricing
View Details
Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit
MBS9335545-04 10x 96 Well

Mouse Single Ig IL-1-related receptor, SIGIRR ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Prostaglandin F2 Receptor Negative Regulator (PTGFRN)
MBS2093746-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Prostaglandin F2 Receptor Negative Regulator (PTGFRN)

Sign In for Pricing
View Details