Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli PTP3 protein

This E.coli PTP3 protein spans the amino acid sequence from region 700-1331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTP3

UniProt

R0KX08

Expression Region

700-1331aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Nosema bombycis (strain CQ1 / CVCC 102059) (Microsporidian parasite) (Pebrine of silkworm)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

95.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIKSVIPEDRDEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENSKKIHIDEATAYFKPAAKLKMEKKGIKTDNFRPKTNQGEIRDMPKGETYYEVDLKDADLSLPSPTNPTPDTLVSNGKDVVDVEDVSAIVINKGTLVQTPWNEYSDMIKPKFNPYPNEGEKINQIKKLQKLIADEKRKDTLDRIKVNTITNPDGEKRMIVNTPYGVQEMFEETEGMKRLSHIDPNKNVAISETPTDDNKESIYSAFKNVSPNEAVGKFIEDTFNSAYSSGQAQRFVNPTNAFTGQEDPKKARLMTQKTIDVTEYYINDGKPSSAIKNQLIQNYRALADSLGMTEEDFIQFARKIPDDSLAQMISYNEQSESSRPALVDAPFFKTLQPLANQTSKTKLNDIIKIIFTQISKVTGKTNSTTGTTLEKKIVPNLKAVRSDQVIAGPNGGTSALSQATAPRTGSTVLSKQITRGLPRVPSGTGTSYPVRDPNGINTSEDNERYKVNPYNPYSKSDTSGLEAPGGEIVHNGTRPSPYAIVGVPIVAAVTTPVIRPAVLRTPPAAQSSSSALQGNTALTGAGTPRAGVAGSPGVNPGPTGKAPVSPPAPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)
MBS1468258-01 0.02 mg (E-Coli)

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)
MBS1468258-02 0.1 mg (E-Coli)

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)
MBS1468258-03 0.02 mg (Yeast)

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)
MBS1468258-04 0.1 mg (Yeast)

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)
MBS1468258-05 0.02 mg (Baculovirus)

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)
MBS1468258-06 1 mg (E-Coli)

Recombinant Salmonella choleraesuis Divalent-cation tolerance protein CutA (cutA)

Sign In for Pricing
View Details