Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LYPD6 protein

This Human LYPD6 protein spans the amino acid sequence from region 23-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LYPD6

UniProt

Q86Y78

Expression Region

23-171aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPE Rabbit mAb
E2R23908 100 µL

CENPE Rabbit mAb

Sign In for Pricing
View Details
SMCR8 (NM_144775) Human Tagged Lenti ORF Clone
RC212285L3 10 µg

SMCR8 (NM_144775) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C-Myc(Phospho-Ser373) Antibody FITC Conjugated
C07486F 100 µL

C-Myc(Phospho-Ser373) Antibody FITC Conjugated

Sign In for Pricing
View Details
Olfr1506 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32924114 3x 1.0 µg

Olfr1506 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TGIF (TGIF1) (NM_170695) Human Tagged ORF Clone Lentiviral Particle
RC221666L4V 200 µL

TGIF (TGIF1) (NM_170695) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-VEGF Reference Antibody (Domantis patent anti-VEGF)
MBS9247889-01 0.1 mg

Anti-VEGF Reference Antibody (Domantis patent anti-VEGF)

Sign In for Pricing
View Details