Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LYPD6 protein

This Human LYPD6 protein spans the amino acid sequence from region 23-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LYPD6

UniProt

Q86Y78

Expression Region

23-171aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-soluble liver antigen,SLA ELISA Kit
CN-03587H1 96T

Human anti-soluble liver antigen,SLA ELISA Kit

Sign In for Pricing
View Details
Human Carboxypeptidase E (CPE) AssayLite™ Antibody (APC Conjugate)
31135-05161 5x 30 µg

Human Carboxypeptidase E (CPE) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
P66 beta (GATAD2B) Human Over-expression Lysate
orb1370379 20 µg

P66 beta (GATAD2B) Human Over-expression Lysate

Sign In for Pricing
View Details
PLAGL2 siRNA (Human)
CRH3566-01 15 nmol

PLAGL2 siRNA (Human)

Sign In for Pricing
View Details
PLAGL2 siRNA (Human)
CRH3566-02 30 nmol

PLAGL2 siRNA (Human)

Sign In for Pricing
View Details
TGF-beta 3 (Animal Free)
100-107S-AF 2 µg

TGF-beta 3 (Animal Free)

Sign In for Pricing
View Details