Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ILDR2 protein

This Human ILDR2 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ILDR2

UniProt

Q71H61

Expression Region

1-186aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) GLC3 Polyclonal Antibody
MBS7198388 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) GLC3 Polyclonal Antibody

Sign In for Pricing
View Details
Myo1f-set siRNA/shRNA/RNAi Lentivector (Mouse)
31289094 4x 500 ng

Myo1f-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
GSK 2830371 25mg
A16565-25 25 mg

GSK 2830371 25mg

Sign In for Pricing
View Details
Rabbit Monoclonal IL-15 Antibody (IL15/6971R) [DyLight 488]
NBP3-14101G 0.1 mL

Rabbit Monoclonal IL-15 Antibody (IL15/6971R) [DyLight 488]

Sign In for Pricing
View Details
Polyclonal HSF1 Antibody (aa267-315)
APR07826G 0.05ml

Polyclonal HSF1 Antibody (aa267-315)

Sign In for Pricing
View Details
Mouse Dot1l activation kit by CRISPRa
GA212859 1 Kit

Mouse Dot1l activation kit by CRISPRa

Sign In for Pricing
View Details