Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLK2 protein

This Human DLK2 protein spans the amino acid sequence from region 27-306aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLK2

UniProt

Q6UY11

Expression Region

27-306aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL10 Human
OM303562-01 1 µg

BCL10 Human

Sign In for Pricing
View Details
BCL10 Human
OM303562-02 5 µg

BCL10 Human

Sign In for Pricing
View Details
BCL10 Human
OM303562-03 50 µg

BCL10 Human

Sign In for Pricing
View Details
2-Fluoro-6- (pyrrolidin-1-yl) aniline
IXB84096-01 0.5 g

2-Fluoro-6- (pyrrolidin-1-yl) aniline

Sign In for Pricing
View Details
2-Fluoro-6- (pyrrolidin-1-yl) aniline
IXB84096-02 5 g

2-Fluoro-6- (pyrrolidin-1-yl) aniline

Sign In for Pricing
View Details
BCLG Mouse Monoclonal Antibody
AG5187 50 µL

BCLG Mouse Monoclonal Antibody

Sign In for Pricing
View Details