Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BEND3 protein

This Human BEND3 protein spans the amino acid sequence from region 328-461aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEND3

UniProt

Q5T5X7

Expression Region

328-461aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colon adenocarcinoma tissue Tissue Slides (Adenocarcinoma)
NBP2-61407 5 Slides

Colon adenocarcinoma tissue Tissue Slides (Adenocarcinoma)

Sign In for Pricing
View Details
PURA Polyclonal Antibody, FITC Conjugated
A69673-100 100 µL

PURA Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Proteasome 20S alpha 1 Rabbit Polyclonal Antibody (Cy7)
orb2377079 100 µL

Proteasome 20S alpha 1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
RWDD1L1 CRISPR Knock Out 293T Cell Line (Human)
67139141 1x 10^6 Cells / 1.0 mL

RWDD1L1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
HMGB2 Antibody - C-terminal region : FITC (ARP31939_P050-FITC)
ARP31939_P050-FITC 100 µL

HMGB2 Antibody - C-terminal region : FITC (ARP31939_P050-FITC)

Sign In for Pricing
View Details
Obox6 3'UTR Lenti-reporter-Luc Vector
32414086 1.0 µg

Obox6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details