Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BEND3 protein

This Human BEND3 protein spans the amino acid sequence from region 328-461aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEND3

UniProt

Q5T5X7

Expression Region

328-461aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Influenza A nucleoprotein Antibody (010) [Alexa Fluor 532]
NBP3-12741AF532 100 µL

Rabbit Monoclonal Influenza A nucleoprotein Antibody (010) [Alexa Fluor 532]

Sign In for Pricing
View Details
IFluor® 514 Anti-human CD98 Antibody *MEM-108*
10980061-AAT 500 Tests

IFluor® 514 Anti-human CD98 Antibody *MEM-108*

Sign In for Pricing
View Details
NPRL2 Adenovirus (Mouse)
32100054 1.0 mL

NPRL2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal TRERF1 Antibody [Alexa Fluor 700]
NB100-81655AF700 0.1 mL

Rabbit Polyclonal TRERF1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Anti-Human SAA4 monoclonal antibody, clone NN14
CABT-ZB534 50 μl

Mouse Anti-Human SAA4 monoclonal antibody, clone NN14

Sign In for Pricing
View Details
RGD (Arg-Gly-Asp) Peptides 10mg
A15538-10 10 mg

RGD (Arg-Gly-Asp) Peptides 10mg

Sign In for Pricing
View Details