Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BEND3 protein

This Human BEND3 protein spans the amino acid sequence from region 328-461aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEND3

UniProt

Q5T5X7

Expression Region

328-461aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAS9-H840A Streptococcus Pyogenes Recombinant Protein
PO49241E1 500 pmol

CAS9-H840A Streptococcus Pyogenes Recombinant Protein

Sign In for Pricing
View Details
SI CRISPRa sgRNA lentivector (set of three targets)(Rat)
43738126 3x 1.0µg DNA

SI CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal P-Rex1 Antibody [mFluor Violet 610 SE]
NBP2-98883MFV610 0.1 mL

Rabbit Polyclonal P-Rex1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
MARCH11 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9345R-PerCP-Cy5.5 100 µL

MARCH11 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
RAB27B, Member RAS Oncogene Family (RAB27B), Recombinant, Human, His-Tag
057698-01 10 µg

RAB27B, Member RAS Oncogene Family (RAB27B), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
RAB27B, Member RAS Oncogene Family (RAB27B), Recombinant, Human, His-Tag
057698-02 50 µg

RAB27B, Member RAS Oncogene Family (RAB27B), Recombinant, Human, His-Tag

Sign In for Pricing
View Details