Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BEND3 protein

This Human BEND3 protein spans the amino acid sequence from region 328-461aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEND3

UniProt

Q5T5X7

Expression Region

328-461aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human KDR Monoclonal Clone CIH-11 100ug
IRBAHUKDRCIH11C100ug 100 µg

Rabbit Anti Human KDR Monoclonal Clone CIH-11 100ug

Sign In for Pricing
View Details
CANT1 Antibody
orb2674713-01 50 µL

CANT1 Antibody

Sign In for Pricing
View Details
CANT1 Antibody
orb2674713-02 100 µL

CANT1 Antibody

Sign In for Pricing
View Details
CANT1 Antibody
orb2674713-03 200 µL

CANT1 Antibody

Sign In for Pricing
View Details
Hexa Pneumococci - 4
HX042-1PK 1 unit

Hexa Pneumococci - 4

Sign In for Pricing
View Details
Nipa2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6623008 1.0 µg DNA

Nipa2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details