Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Jak3 protein

This Mouse Jak3 protein spans the amino acid sequence from region 818-1100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Jak3

UniProt

Q62137

Expression Region

818-1100aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFG Antibody
MBS9631243-01 0.1 mL

TFG Antibody

Sign In for Pricing
View Details
TFG Antibody
MBS9631243-02 0.2 mL

TFG Antibody

Sign In for Pricing
View Details
TFG Antibody
MBS9631243-03 5x 0.2 mL

TFG Antibody

Sign In for Pricing
View Details
OR6C64P Recombinant Protein (Human)
RP081156 100 µg

OR6C64P Recombinant Protein (Human)

Sign In for Pricing
View Details
Cavy Tachykinin Receptor 1 ELISA Kit
MBS091399 Inquire

Cavy Tachykinin Receptor 1 ELISA Kit

Sign In for Pricing
View Details
GAMT Recombinant Protein Antigen
NBP2-14036PEP 0.1 mL

GAMT Recombinant Protein Antigen

Sign In for Pricing
View Details