Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFAIP8 protein

This Human TNFAIP8 protein spans the amino acid sequence from region 2-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNFAIP8

UniProt

O95379

Expression Region

2-198aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NADPH oxidase 4 (Rabbit, Monoclonal)
A104954 100 µL

Anti-NADPH oxidase 4 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Goat Mouse IgG (H&L), F (ab) '2 fragment, HRP conjugated Antibody
orb700423 0.5 mg

Goat Mouse IgG (H&L), F (ab) '2 fragment, HRP conjugated Antibody

Sign In for Pricing
View Details
SATB Homeobox 2 (SATB2) Antibody
abx218442 100 µg

SATB Homeobox 2 (SATB2) Antibody

Sign In for Pricing
View Details
RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) (APC)
132907-APC 100 µL

RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) (APC)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS639380 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
EF-HA1 CRISPR/Cas9 KO Plasmid (h)
sc-407879 20 µg

EF-HA1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details