Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFAIP8 protein

This Human TNFAIP8 protein spans the amino acid sequence from region 2-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNFAIP8

UniProt

O95379

Expression Region

2-198aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VP40 Antibody
CSB-PA762349HA01ZAT-01 50 μL

VP40 Antibody

Sign In for Pricing
View Details
VP40 Antibody
CSB-PA762349HA01ZAT-02 100 µL

VP40 Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human EGFR (Epidermal growth factor receptor) expressed in Sf9 for Antibody Discovery
MP0133Q Each

Magic™ Membrane Protein Human EGFR (Epidermal growth factor receptor) expressed in Sf9 for Antibody Discovery

Sign In for Pricing
View Details
LOC100364156 3'UTR GFP Stable Cell Line
TU258990 1.0 mL

LOC100364156 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PP2A / PPP2R1A Immunizing Peptide
MBS426061-01 0.1 mg

PP2A / PPP2R1A Immunizing Peptide

Sign In for Pricing
View Details
PP2A / PPP2R1A Immunizing Peptide
MBS426061-02 5x 0.1 mg

PP2A / PPP2R1A Immunizing Peptide

Sign In for Pricing
View Details