Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFAIP8 protein

This Human TNFAIP8 protein spans the amino acid sequence from region 2-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNFAIP8

UniProt

O95379

Expression Region

2-198aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMELX (Amelogenin (Amelogenesis Imperfecta 1, X-Linked), AIH1, ALGN, AMG, AMGL, AMGX) (HRP)
243299-HRP 100 µL

AMELX (Amelogenin (Amelogenesis Imperfecta 1, X-Linked), AIH1, ALGN, AMG, AMGL, AMGX) (HRP)

Sign In for Pricing
View Details
Epithelial Cell Adhesion Molecule (EPCAM) Antibody
abx239870 100 µg

Epithelial Cell Adhesion Molecule (EPCAM) Antibody

Sign In for Pricing
View Details
Calr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4508807 1.0 µg DNA

Calr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Topoisomerase II alpha Antibody
KC-589-01 50 μL

Topoisomerase II alpha Antibody

Sign In for Pricing
View Details
Topoisomerase II alpha Antibody
KC-589-02 100 µL

Topoisomerase II alpha Antibody

Sign In for Pricing
View Details
Topoisomerase II alpha Antibody
KC-589-03 1 mL

Topoisomerase II alpha Antibody

Sign In for Pricing
View Details