Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRMP1 protein

This Human CRMP1 protein spans the amino acid sequence from region 1-572aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRMP1

UniProt

Q14194

Expression Region

1-572aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Regulator of Microtubule Dynamics Protein 2 (FAM82A1) ELISA Kit
MBS9946175 Inquire

Rabbit Regulator of Microtubule Dynamics Protein 2 (FAM82A1) ELISA Kit

Sign In for Pricing
View Details
BAG5 Polyclonal Antibody
E-AB-13863-01 20 µL

BAG5 Polyclonal Antibody

Sign In for Pricing
View Details
BAG5 Polyclonal Antibody
E-AB-13863-02 60 µL

BAG5 Polyclonal Antibody

Sign In for Pricing
View Details
BAG5 Polyclonal Antibody
E-AB-13863-03 120 µL

BAG5 Polyclonal Antibody

Sign In for Pricing
View Details
BAG5 Polyclonal Antibody
E-AB-13863-04 200 µL

BAG5 Polyclonal Antibody

Sign In for Pricing
View Details
CD66acd Antibody
GWB-3CA58A 0.2 mg

CD66acd Antibody

Sign In for Pricing
View Details