Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD147 protein

This Human CD147 protein spans the amino acid sequence from region 138-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5A11 antigen protein, 5F7 protein, BASI_HUMAN protein, Basigin (Ok blood group) protein, Basigin protein, Blood brain barrier HT7 antigen protein, BSG protein, CD 147 protein, CD147 protein, CD147 antigen protein, Collagenase stimulatory factor protein, Emmprin protein, Extracellular matrix metalloproteinase inducer protein, Leukocyte activation antigen M6 protein, M 6 protein, M6 protein, M6 antigen protein, M6 leukocyte activation antigen protein, Neurothelin protein, OK protein, OK blood group protein, OK blood group antigen protein, TCSF protein, Tumor cell derived collagenase stimulatory factor protein, Tumor cell-derived collagenase stimulatory factor protein

UniProt

P35613

Expression Region

138-321aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Ameloblastin (AMBN)
MBS1407237-01 0.02 mg (E-Coli)

Recombinant Bovine Ameloblastin (AMBN)

Sign In for Pricing
View Details
Recombinant Bovine Ameloblastin (AMBN)
MBS1407237-02 0.02 mg (Yeast)

Recombinant Bovine Ameloblastin (AMBN)

Sign In for Pricing
View Details
Recombinant Bovine Ameloblastin (AMBN)
MBS1407237-03 0.1 mg (E-Coli)

Recombinant Bovine Ameloblastin (AMBN)

Sign In for Pricing
View Details
Recombinant Bovine Ameloblastin (AMBN)
MBS1407237-04 0.1 mg (Yeast)

Recombinant Bovine Ameloblastin (AMBN)

Sign In for Pricing
View Details
Recombinant Bovine Ameloblastin (AMBN)
MBS1407237-05 0.02 mg (Baculovirus)

Recombinant Bovine Ameloblastin (AMBN)

Sign In for Pricing
View Details
Recombinant Bovine Ameloblastin (AMBN)
MBS1407237-06 0.02 mg (Mammalian-Cell)

Recombinant Bovine Ameloblastin (AMBN)

Sign In for Pricing
View Details