Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCN1 protein

This Human RCN1 protein spans the amino acid sequence from region 31-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RCN1, RCN, 1

UniProt

Q15293

Expression Region

31-331aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC8A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
39575111 3x 1.0 µg

RIC8A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody
TA306234 100 µg

CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASMT (NM_004043) Human Over-expression Lysate
LH07008V 100 µg

ASMT (NM_004043) Human Over-expression Lysate

Sign In for Pricing
View Details
Goat Anti-Llama IgG (H+L chain) -RPE conjugate
30817-RPE 0.5 mL

Goat Anti-Llama IgG (H+L chain) -RPE conjugate

Sign In for Pricing
View Details
Human PTCH1 / Protein patched homolog 1 Recombinant Protein
R14722h 1 Each

Human PTCH1 / Protein patched homolog 1 Recombinant Protein

Sign In for Pricing
View Details
PD153035 (HCl salt) 25mg
A10702-25 25 mg

PD153035 (HCl salt) 25mg

Sign In for Pricing
View Details