Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCN1 protein

This Human RCN1 protein spans the amino acid sequence from region 31-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RCN1, RCN, 1

UniProt

Q15293

Expression Region

31-331aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF732 Antibody - N-terminal region : FITC (ARP35683_P050-FITC)
ARP35683_P050-FITC 100 µL

ZNF732 Antibody - N-terminal region : FITC (ARP35683_P050-FITC)

Sign In for Pricing
View Details
Phospho-Cofilin (Ser3) Rabbit Polyclonal Antibody (Cy5.5)
orb1079414 100 µL

Phospho-Cofilin (Ser3) Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
CACNB4 Rabbit Polyclonal Antibody
E10G06119 100 µL

CACNB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLXND1 Protein Vector (Human) (pPB-N-His)
PV111947 500 ng

PLXND1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
RPL32P23 CRISPRa sgRNA lentivector (set of three targets)(Human)
41427121 3x 1.0µg DNA

RPL32P23 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Human FAS-associated death domain protein (FADD)
CSB-EP623788HU-01 20 µg

Recombinant Human FAS-associated death domain protein (FADD)

Sign In for Pricing
View Details