Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCN1 protein

This Human RCN1 protein spans the amino acid sequence from region 31-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RCN1, RCN, 1

UniProt

Q15293

Expression Region

31-331aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig POU Class 5 Homeobox 1 / OCT4 (POU5F1) ELISA Kit
abx517716 96 Tests

Pig POU Class 5 Homeobox 1 / OCT4 (POU5F1) ELISA Kit

Sign In for Pricing
View Details
HnRNP I (A-4) P
sc-515282 P 100 µg - 0.5 mL

HnRNP I (A-4) P

Sign In for Pricing
View Details
ISGF3G (Interferon Regulatory Factor 9, IRF-9, ISGF3, ISGF3G, p48) (MaxLight 405) discontinued
247737-ML405 100 µL

ISGF3G (Interferon Regulatory Factor 9, IRF-9, ISGF3, ISGF3G, p48) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Fibronectin (FN) AssayLite™ Antibody (FITC Conjugate)
11341-05041 2x 75 µg

Human Fibronectin (FN) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Rabbit Anti Human CASP12 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120UL
IRBAMLCASP12AP02120UL 120 µL

Rabbit Anti Human CASP12 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120UL

Sign In for Pricing
View Details
Phospho-RPS6KB1 (Ser427) Rabbit Polyclonal Antibody (APC-Cy7)
orb1576232 100 µL

Phospho-RPS6KB1 (Ser427) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details