Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FHIT protein

This Human FHIT protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FHIT

UniProt

P49789

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CATSPER1 (NM_053054) Human Untagged Clone
SC123099 10 µg

CATSPER1 (NM_053054) Human Untagged Clone

Sign In for Pricing
View Details
Human Zinc finger protein 74 (ZNF74) ELISA Kit
abx384494 96 Tests

Human Zinc finger protein 74 (ZNF74) ELISA Kit

Sign In for Pricing
View Details
Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)
MBS1114477-01 0.02 mg (E-Coli)

Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)

Sign In for Pricing
View Details
Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)
MBS1114477-02 0.1 mg (E-Coli)

Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)

Sign In for Pricing
View Details
Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)
MBS1114477-03 0.02 mg (Yeast)

Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)

Sign In for Pricing
View Details
Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)
MBS1114477-04 0.1 mg (Yeast)

Recombinant Pseudorasbora parva Tiggy-winkle hedgehog protein (twhh)

Sign In for Pricing
View Details