What is the catalog number for Yeast Core protein?

The catalog number for Yeast Core protein is orb246144.

What sizes are available for Yeast Core protein?

Yeast Core protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Yeast Core protein come in?

Yeast Core protein is available in 3 different pack sizes.

Is Yeast Core protein in stock?

Yeast Core protein is currently made to order / not held in immediate stock. Contact us for lead time.

Yeast Core protein

This Yeast Core protein spans the amino acid sequence from region 2-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Core protein

UniProt

O92972

Expression Region

2-177aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Hepatitis C virus genotype 1a (isolate 1) (HCV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKASERSQPRGRRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIF