Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast cry1Fb protein

This Yeast cry1Fb protein spans the amino acid sequence from region 984-1169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cry1Fb

UniProt

O66377

Expression Region

984-1169aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus thuringiensis subsp. morrisoni

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-5692b miRNA Inhibitor
orb1871648-01 10 nmol

Hsa-miR-5692b miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-5692b miRNA Inhibitor
orb1871648-02 20 nmol

Hsa-miR-5692b miRNA Inhibitor

Sign In for Pricing
View Details
Hantavirus NC (HN-1)
sc-65928 100 µg/mL

Hantavirus NC (HN-1)

Sign In for Pricing
View Details
YIPF3 Polyclonal Antibody
RA36271-01 50 µL

YIPF3 Polyclonal Antibody

Sign In for Pricing
View Details
YIPF3 Polyclonal Antibody
RA36271-02 100 µL

YIPF3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PLEKHF2 Antibody
NBP2-85490-0.1mL 0.1 mL

Rabbit Polyclonal PLEKHF2 Antibody

Sign In for Pricing
View Details