Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast MRJP1 protein

This Yeast MRJP1 protein spans the amino acid sequence from region 20-432aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRJP1

UniProt

O18330

Expression Region

20-432aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Apis mellifera (Honeybee)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tris-HCl Buffer 1M, pH 7.8
42020276-1 1 L

Tris-HCl Buffer 1M, pH 7.8

Sign In for Pricing
View Details
WDR1 CRISPR/Cas9 KO Plasmid (m)
sc-423701 20 µg

WDR1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Human OCIAD1 (NM_001079841) AAV Particle
RC221863A1V 250 µL

Human OCIAD1 (NM_001079841) AAV Particle

Sign In for Pricing
View Details
Rat AMH (Anti-Mullerian Hormone) ELISA Kit
EK250194 96 Well

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Macrophage Inflammatory Protein 1 Beta (MIP1b)
RPU42644-01 50 µg

Recombinant Rat Macrophage Inflammatory Protein 1 Beta (MIP1b)

Sign In for Pricing
View Details
Recombinant Rat Macrophage Inflammatory Protein 1 Beta (MIP1b)
RPU42644-02 100 µg

Recombinant Rat Macrophage Inflammatory Protein 1 Beta (MIP1b)

Sign In for Pricing
View Details