What is the catalog number for Yeast Thrombin-like enzyme crotalase protein?

The catalog number for Yeast Thrombin-like enzyme crotalase protein is orb246138.

What sizes are available for Yeast Thrombin-like enzyme crotalase protein?

Yeast Thrombin-like enzyme crotalase protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Yeast Thrombin-like enzyme crotalase protein come in?

Yeast Thrombin-like enzyme crotalase protein is available in 3 different pack sizes.

Is Yeast Thrombin-like enzyme crotalase protein in stock?

Yeast Thrombin-like enzyme crotalase protein is currently made to order / not held in immediate stock. Contact us for lead time.

Yeast Thrombin-like enzyme crotalase protein

This Yeast Thrombin-like enzyme crotalase protein spans the amino acid sequence from region 25-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombin-like enzyme crotalase, SVTLE, EC 3.4.21.74, Fibrinogen-clotting enzyme, Snake venom serine protease 2, SVSP

UniProt

F8S114

Expression Region

25-262aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Crotalus adamanteus (Eastern diamondback rattlesnake)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP