Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human gL protein

This Human gL protein spans the amino acid sequence from region 31-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GL

UniProt

F5HCH8

Expression Region

31-278aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody
abx227134-01 40 µL

Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody
abx227134-02 100 µL

Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody
abx227134-03 200 µL

Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody
abx227134-04 500 µL

Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody
abx227134-05 1 mL

Chromatin Assembly Factor 1 Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
ASPG, ID (ASPG, C14orf76, 60kD lysophospholipase, L-asparaginase, L-asparagine amidohydrolase, Platelet-activating factor acetylhydrolase) (MaxLight 650) discontinued
032143-ML650 100 µL

ASPG, ID (ASPG, C14orf76, 60kD lysophospholipase, L-asparaginase, L-asparagine amidohydrolase, Platelet-activating factor acetylhydrolase) (MaxLight 650) discontinued

Sign In for Pricing
View Details