Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human gL protein

This Human gL protein spans the amino acid sequence from region 31-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GL

UniProt

F5HCH8

Expression Region

31-278aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MYL9 (S18) Antibody
A23349-50UG 50 µg

Phospho-MYL9 (S18) Antibody

Sign In for Pricing
View Details
Monoclonal ACYP1 Antibody (monoclonal) (M01), Clone: 1B2-3A2
APG01541G 0.1mg

Monoclonal ACYP1 Antibody (monoclonal) (M01), Clone: 1B2-3A2

Sign In for Pricing
View Details
E2F1 Human Gene Knockout Kit (CRISPR)
KN208247LP 1 Kit

E2F1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human TAF11 Protein, GST, E.coli-50ug
QP7620-ec-50ug 50ug

Recombinant Human TAF11 Protein, GST, E.coli-50ug

Sign In for Pricing
View Details
Duck Progesterone Receptor ELISA Kit
MBS057618 Inquire

Duck Progesterone Receptor ELISA Kit

Sign In for Pricing
View Details
SFRS7 Rabbit Polyclonal Antibody
orb583070 100 µL

SFRS7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details