Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human gL protein

This Human gL protein spans the amino acid sequence from region 31-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GL

UniProt

F5HCH8

Expression Region

31-278aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F9 3'UTR GFP Stable Cell Line
TU156066 1.0 mL

F9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF488A conjugate, 0.1mg/mL
BNC883497-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nlrp4a Rat shRNA Lentiviral Particle (Locus ID 292545)
TL704807V 500 µL Each

Nlrp4a Rat shRNA Lentiviral Particle (Locus ID 292545)

Sign In for Pricing
View Details
1- (3,4-dimethoxyphenyl) -2- (4-allly-2,6-dimethoxyphenoxy) propan-1-ol
299775 5 mg

1- (3,4-dimethoxyphenyl) -2- (4-allly-2,6-dimethoxyphenoxy) propan-1-ol

Sign In for Pricing
View Details
Mmu-miR-7065-3p miRNA Agomir
orb1917368-01 5 nmol

Mmu-miR-7065-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7065-3p miRNA Agomir
orb1917368-02 10 nmol

Mmu-miR-7065-3p miRNA Agomir

Sign In for Pricing
View Details