Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast NSP4 protein

This Yeast NSP4 protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NSP4

UniProt

P04512

Expression Region

52-175aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rotavirus A (strain RVA/SA11-Both/G3P5B[2]) (RV-A) (Simian Agent 11 (strain Both) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ki-67 Protein (Ki-67) ELISA Kit
EKU05485 96 Tests

Human Ki-67 Protein (Ki-67) ELISA Kit

Sign In for Pricing
View Details
IgG1 Fc (NNAS) Protein, Human
UA050008-01 100 µg

IgG1 Fc (NNAS) Protein, Human

Sign In for Pricing
View Details
IgG1 Fc (NNAS) Protein, Human
UA050008-02 500 µg

IgG1 Fc (NNAS) Protein, Human

Sign In for Pricing
View Details
Human CDH26 Pre-designed siRNA Set A
SI002675A 1 Each

Human CDH26 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SEC23IP Rabbit Polyclonal Antibody (HRP)
orb2109503 100 µL

SEC23IP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human RTCA Protein, His, E.coli-100ug
QP13368-100ug 100ug

Recombinant Human RTCA Protein, His, E.coli-100ug

Sign In for Pricing
View Details