Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast lolA protein

This Yeast lolA protein spans the amino acid sequence from region 22-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LolA

UniProt

A7ZYJ5

Expression Region

22-203aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli O9:H4 (strain HS)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SNX30 Protein Lysate
MBS8419966-01 0.02 mg

Human SNX30 Protein Lysate

Sign In for Pricing
View Details
Human SNX30 Protein Lysate
MBS8419966-02 5x 0.02 mg

Human SNX30 Protein Lysate

Sign In for Pricing
View Details
IGLON5 Polyclonal Antibody, Cy5 Conjugated
bs-15578R-Cy5 100 µL

IGLON5 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
MFNG/Manic Fringe Rabbit anti-Human Polyclonal (aa211-260) Antibody
MBS2402131-01 0.05 mL

MFNG/Manic Fringe Rabbit anti-Human Polyclonal (aa211-260) Antibody

Sign In for Pricing
View Details
MFNG/Manic Fringe Rabbit anti-Human Polyclonal (aa211-260) Antibody
MBS2402131-02 5x 0.05 mL

MFNG/Manic Fringe Rabbit anti-Human Polyclonal (aa211-260) Antibody

Sign In for Pricing
View Details
NMRAL1 Polyclonal Conjugated Antibody
C29468 100 µL

NMRAL1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details