Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine SERPINA3-2 protein

This Bovine SERPINA3-2 protein spans the amino acid sequence from region 25-411aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SERPINA3 Protein, AACT Protein, AACT_HUMAN Protein, ACT Protein, Chymotrypsin alpha 1 Protein, Alpha-1-antichymotrypsin His-Pro-less Protein, Chymotrypsin Protein, Antichymotrypsin Protein, Serpin A3 Protein, SERPINA3 Protein

UniProt

A2I7M9

Expression Region

25-411aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGVAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRG1 CRISPR/Cas9 KO Plasmid (h)
sc-417509 20 µg

FRG1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae mhp179 Protein (aa 1-143)
VAng-Lsx06462-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Hyopneumoniae mhp179 Protein (aa 1-143)

Sign In for Pricing
View Details
ZNF583 Antibody - N-terminal region : Biotin (ARP36188_P050-Biotin)
ARP36188_P050-Biotin 100 µL

ZNF583 Antibody - N-terminal region : Biotin (ARP36188_P050-Biotin)

Sign In for Pricing
View Details
Rat Monoclonal ACE-2 Antibody (379131) [FITC]
FAB9334F 0.1 mL

Rat Monoclonal ACE-2 Antibody (379131) [FITC]

Sign In for Pricing
View Details
MDH1 Recombinant Antibody
bsm-62167R-TR 20 µL

MDH1 Recombinant Antibody

Sign In for Pricing
View Details
Rat CASP7 (Caspase 7) ELISA Kit
MBS2514586-01 24 Tests (Limit 1)

Rat CASP7 (Caspase 7) ELISA Kit

Sign In for Pricing
View Details