Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast aglB protein

This Yeast aglB protein spans the amino acid sequence from region 21-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AglB

UniProt

A2QEJ9

Expression Region

21-443aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF405S conjugate, 0.1mg/mL
BNC042056-500 1x 500 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRDG 1 (STAP1) Rabbit Polyclonal Antibody
TA369840 100 µL

BRDG 1 (STAP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD153 (TNFSF8) Rabbit Polyclonal Antibody
AP01279PU-N 100 µg

CD153 (TNFSF8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zomepirac Sodium Salt
TRC-Z675000-100MG 100 mg

Zomepirac Sodium Salt

Sign In for Pricing
View Details
ZFAND5 (NM_001278243) Human Tagged ORF Clone
RG236609 10 µg

ZFAND5 (NM_001278243) Human Tagged ORF Clone

Sign In for Pricing
View Details
AdSS 2 (ADSS) (NM_001126) Human Recombinant Protein
TP304256 20 µg

AdSS 2 (ADSS) (NM_001126) Human Recombinant Protein

Sign In for Pricing
View Details