Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast aglB protein

This Yeast aglB protein spans the amino acid sequence from region 21-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AglB

UniProt

A2QEJ9

Expression Region

21-443aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Viperin (RSAD2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D12]
TA505799AM 100 µL

Viperin (RSAD2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D12]

Sign In for Pricing
View Details
ARRB1 Rabbit Monoclonal Antibody [Clone ID: 23GB1755]
TA424530S 20 µL

ARRB1 Rabbit Monoclonal Antibody [Clone ID: 23GB1755]

Sign In for Pricing
View Details
10 hydroxy nalmefene
TRC-H479780-25MG 25 mg

10 hydroxy nalmefene

Sign In for Pricing
View Details
2-Aminobiphenyl-2’,3’,4’,5’,6’-d5
TRC-A601768-5MG 5 mg

2-Aminobiphenyl-2’,3’,4’,5’,6’-d5

Sign In for Pricing
View Details
PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
CF810710 100 µg

PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]

Sign In for Pricing
View Details
Caragana arborescens Gel -CAA- Immobilized Lectin
A-6701-2 2 mL

Caragana arborescens Gel -CAA- Immobilized Lectin

Sign In for Pricing
View Details