Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast aglB protein

This Yeast aglB protein spans the amino acid sequence from region 21-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AglB

UniProt

A2QEJ9

Expression Region

21-443aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab3a Mouse Gene Knockout Kit (CRISPR)
KN514363 1 Kit

Rab3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS706752 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
GFP, AlpSdAbs® VHH (Biotin)
HA710186 100 µg

GFP, AlpSdAbs® VHH (Biotin)

Sign In for Pricing
View Details
Vitamin D3 Receptor (Ab-51) Antibody
8B8205-AAT 50 µg

Vitamin D3 Receptor (Ab-51) Antibody

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF640R conjugate, 0.1mg/mL
BNC400498-500 1x 500 µL

PAX6 (PAX6/498), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS716678 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details