Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast aglB protein

This Yeast aglB protein spans the amino acid sequence from region 21-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AglB

UniProt

A2QEJ9

Expression Region

21-443aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 1/CD38 (N-6His-Avi) Biotinylated
PKSH033880-01 20 µg

Recombinant Human ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 1/CD38 (N-6His-Avi) Biotinylated

Sign In for Pricing
View Details
Recombinant Human ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 1/CD38 (N-6His-Avi) Biotinylated
PKSH033880-02 100 µg

Recombinant Human ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 1/CD38 (N-6His-Avi) Biotinylated

Sign In for Pricing
View Details
DAP1 (DAP) (NM_001291963) Human Tagged ORF Clone
RG236541 10 µg

DAP1 (DAP) (NM_001291963) Human Tagged ORF Clone

Sign In for Pricing
View Details
MARS2 Human Gene Knockout Kit (CRISPR)
KN424966 1 Kit

MARS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Recombinant Rabbit monoclonal Antibody
HA751175 100 µL

Histone H3 (mono methyl K79) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TEX22 (NM_001195082) Human Over-expression Lysate
LC433992 20 µg

TEX22 (NM_001195082) Human Over-expression Lysate

Sign In for Pricing
View Details