Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast cry1Ab protein

This Yeast cry1Ab protein spans the amino acid sequence from region 1022-1155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cry1Ab

UniProt

P0A370

Expression Region

1022-1155aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus thuringiensis subsp. kurstaki

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FGFR2 Antibody (2E9)
NBP3-26583-100ul 100 µL

Rabbit Monoclonal FGFR2 Antibody (2E9)

Sign In for Pricing
View Details
VPS29 Polyclonal Antibody
RD81224A-01 60 μL

VPS29 Polyclonal Antibody

Sign In for Pricing
View Details
VPS29 Polyclonal Antibody
RD81224A-02 120 μL

VPS29 Polyclonal Antibody

Sign In for Pricing
View Details
VPS29 Polyclonal Antibody
RD81224A-03 200 µL

VPS29 Polyclonal Antibody

Sign In for Pricing
View Details
Pde1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
36277116 3x 1.0 µg

Pde1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ZDHHC7 Rabbit Polyclonal Antibody (RBITC)
orb1056402 100 µL

ZDHHC7 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details