Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast cry1Ab protein

This Yeast cry1Ab protein spans the amino acid sequence from region 1022-1155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cry1Ab

UniProt

P0A370

Expression Region

1022-1155aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus thuringiensis subsp. kurstaki

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF1 Antibody - N-terminal region
ARP39021_P050-25UL 25 µL

UHRF1 Antibody - N-terminal region

Sign In for Pricing
View Details
PSKH1 shRNA (h) Lentiviral Particles
sc-93066-V 200 µL

PSKH1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Lentiviral mouse Jrk shRNA (UAS) - Lentiviral mouse Jrk shRNA (UAS) (100)
GTR15264342 1 Vial

Lentiviral mouse Jrk shRNA (UAS) - Lentiviral mouse Jrk shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-FAM84B Antibody
CPA4983-01 30 µL

Anti-FAM84B Antibody

Sign In for Pricing
View Details
Anti-FAM84B Antibody
CPA4983-02 50 μL

Anti-FAM84B Antibody

Sign In for Pricing
View Details
Anti-FAM84B Antibody
CPA4983-03 100 µL

Anti-FAM84B Antibody

Sign In for Pricing
View Details