Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mup8 protein

This Mouse Mup8 protein spans the amino acid sequence from region 32-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mup8

UniProt

P04938

Expression Region

32-181aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH6 (Membrane-Associated Ring Finger (C3HC4) 6, KIAA0597, MARCH-VI, RNF176, TEB4)
248540 100 µg

MARCH6 (Membrane-Associated Ring Finger (C3HC4) 6, KIAA0597, MARCH-VI, RNF176, TEB4)

Sign In for Pricing
View Details
CES1P1 Antibody Blocking Peptide
orb1512886 500 µg

CES1P1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Anti-Fluorescein [4-4-20 (enhanced)]
MBS488034-01 0.2 mg

Anti-Fluorescein [4-4-20 (enhanced)]

Sign In for Pricing
View Details
Anti-Fluorescein [4-4-20 (enhanced)]
MBS488034-02 5x 0.2 mg

Anti-Fluorescein [4-4-20 (enhanced)]

Sign In for Pricing
View Details
Mouse Monoclonal Anthrax PA Antibody (PA6) [DyLight 550]
NBP1-97535R 0.1 mL

Mouse Monoclonal Anthrax PA Antibody (PA6) [DyLight 550]

Sign In for Pricing
View Details
Mouse Syntenin 2 (ST2) ELISA Kit
RDR-ST2-Mu-01 96 Tests

Mouse Syntenin 2 (ST2) ELISA Kit

Sign In for Pricing
View Details