Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hbb-b2 protein

This Mouse Hbb-b2 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

UniProt

P02089

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetrabutylphosphonium chloride
IN-0015-TG-0025 25 g

Tetrabutylphosphonium chloride

Sign In for Pricing
View Details
Anti-Zebrafish Cops8 Antibody Fluoro550 Conjugated
DZ41030-Fluoro550 200 µL/Vial

Anti-Zebrafish Cops8 Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
AFF4 Rabbit pAb
orb2714157-01 50 µL

AFF4 Rabbit pAb

Sign In for Pricing
View Details
AFF4 Rabbit pAb
orb2714157-02 100 µL

AFF4 Rabbit pAb

Sign In for Pricing
View Details
TNFRSF 18 Recombinant Protein N-Fc Tag Lyophilized
MBS8434655-01 0.05 mg

TNFRSF 18 Recombinant Protein N-Fc Tag Lyophilized

Sign In for Pricing
View Details
TNFRSF 18 Recombinant Protein N-Fc Tag Lyophilized
MBS8434655-02 5x 0.05 mg

TNFRSF 18 Recombinant Protein N-Fc Tag Lyophilized

Sign In for Pricing
View Details