Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast lptA protein

This Yeast lptA protein spans the amino acid sequence from region 28-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LptA

UniProt

P0ADV1

Expression Region

28-185aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6866-3p antagomir
HY-RI02292A-01 5 nmol

Hsa-miR-6866-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-6866-3p antagomir
HY-RI02292A-02 20 nmol

Hsa-miR-6866-3p antagomir

Sign In for Pricing
View Details
GARNL3 Rabbit pAb, AP conjugated
orb2879450 100 µL

GARNL3 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
GENLISA Hamster Prostaglandin A2 (PGA-2) ELISA
KLH1227 1x 96 Well

GENLISA Hamster Prostaglandin A2 (PGA-2) ELISA

Sign In for Pricing
View Details
SRSF9 Antibody, Biotin conjugated
CSB-PA00214D0Rb-01 50 µg

SRSF9 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SRSF9 Antibody, Biotin conjugated
CSB-PA00214D0Rb-02 100 µg

SRSF9 Antibody, Biotin conjugated

Sign In for Pricing
View Details