Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast lptA protein

This Yeast lptA protein spans the amino acid sequence from region 28-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LptA

UniProt

P0ADV1

Expression Region

28-185aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNIP4 Protein Vector (Mouse) (pPM-C-His)
PV193461 500 ng

KCNIP4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ZNF733 Protein Vector (Human) (pPB-C-His)
PV145518 500 ng

ZNF733 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CCL15 Antibody (HRP)
orb415074-01 50 µg

CCL15 Antibody (HRP)

Sign In for Pricing
View Details
CCL15 Antibody (HRP)
orb415074-02 100 µg

CCL15 Antibody (HRP)

Sign In for Pricing
View Details
1-Butyl-3-methylimidazolium bis (fluorosulfonyl) imide
IL-0345-HP-0100 100 g

1-Butyl-3-methylimidazolium bis (fluorosulfonyl) imide

Sign In for Pricing
View Details
SNX20 Rabbit Polyclonal Antibody (Fluoro647)
orb3093800 100 µg

SNX20 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details