Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MDK protein

This Human MDK protein spans the amino acid sequence from region 21-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MDK, MK1, NEGF2

UniProt

P21741

Expression Region

21-143aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGDS Rabbit Polyclonal Antibody (Cy3)
orb3127701 100 µg

PTGDS Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris UPF0060 membrane protein RPD_3084 (RPD_3084), partial
MBS7073767 Inquire

Recombinant Rhodopseudomonas palustris UPF0060 membrane protein RPD_3084 (RPD_3084), partial

Sign In for Pricing
View Details
eIF1A (EIF1AX) Human Gene Knockout Kit (CRISPR)
KN410335 1 Kit

eIF1A (EIF1AX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Ribonuclease HI (rnhA)
MBS1482221-01 0.02 mg (E-Coli)

Recombinant Shewanella oneidensis Ribonuclease HI (rnhA)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Ribonuclease HI (rnhA)
MBS1482221-02 0.1 mg (E-Coli)

Recombinant Shewanella oneidensis Ribonuclease HI (rnhA)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Ribonuclease HI (rnhA)
MBS1482221-03 0.02 mg (Yeast)

Recombinant Shewanella oneidensis Ribonuclease HI (rnhA)

Sign In for Pricing
View Details