Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MDK protein

This Human MDK protein spans the amino acid sequence from region 21-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MDK, MK1, NEGF2

UniProt

P21741

Expression Region

21-143aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Protein Tyrosine Phosphatase, Non Receptor Type 14 (PTPN14)
RPU51675-01 50 µg

Recombinant Rat Protein Tyrosine Phosphatase, Non Receptor Type 14 (PTPN14)

Sign In for Pricing
View Details
Recombinant Rat Protein Tyrosine Phosphatase, Non Receptor Type 14 (PTPN14)
RPU51675-02 100 µg

Recombinant Rat Protein Tyrosine Phosphatase, Non Receptor Type 14 (PTPN14)

Sign In for Pricing
View Details
Recombinant Rat Protein Tyrosine Phosphatase, Non Receptor Type 14 (PTPN14)
RPU51675-03 1 mg

Recombinant Rat Protein Tyrosine Phosphatase, Non Receptor Type 14 (PTPN14)

Sign In for Pricing
View Details
Recombinant Human TRAF6 Protein, N-His
AP93146 50 µg

Recombinant Human TRAF6 Protein, N-His

Sign In for Pricing
View Details
SSXB10 Adenovirus (Mouse)
45584054 1.0 mL

SSXB10 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Human Nectin-2/PVRL2/CD112 Protein
RP01346-01 10 μg

Recombinant Human Nectin-2/PVRL2/CD112 Protein

Sign In for Pricing
View Details