Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MDK protein

This Human MDK protein spans the amino acid sequence from region 21-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MDK, MK1, NEGF2

UniProt

P21741

Expression Region

21-143aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL4 Matched Antibody Pair Set [ABP-S-07630]
ABP-S-07630 5 Plates

Human IL4 Matched Antibody Pair Set [ABP-S-07630]

Sign In for Pricing
View Details
Ganoderenic acid H
HY-129160 1 Each

Ganoderenic acid H

Sign In for Pricing
View Details
Rhox11 3'UTR GFP Stable Cell Line
TU269417 1.0 mL

Rhox11 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Anti-Thrombin III (AT-III) Elisa Kit
EK720643 96 Well

Rat Anti-Thrombin III (AT-III) Elisa Kit

Sign In for Pricing
View Details
C8a (NM_001106670) Rat Untagged Clone
RN215665 10 µg

C8a (NM_001106670) Rat Untagged Clone

Sign In for Pricing
View Details
SARS-CoV-2 coronavirus nucleocapsid protein
30-2009 1 mg

SARS-CoV-2 coronavirus nucleocapsid protein

Sign In for Pricing
View Details