Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD24 protein

This Human CD24 protein spans the amino acid sequence from region 27-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD 24 protein, CD24 protein, CD-24 protein , CD24 antigen protein, CD24 molecule protein, CD24A protein, GPI linked surface mucin protein, GPI linked surface mucin protein, Heat stable antigen protein, HSA protein, Nectadrin protein, Signal transducer CD24 protein

UniProt

P25063

Expression Region

27-80aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ERK1/2 (Thr202/Thr185) Rabbit Monoclonal Antibody
E10G20214 100 µL

Phospho-ERK1/2 (Thr202/Thr185) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Nefopam Hydrochloride
TRC-N389400-100MG 100 mg

Nefopam Hydrochloride

Sign In for Pricing
View Details
IQGA2 Polyclonal Antibody
E11-201154 100 µg -100 µL

IQGA2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat B-lymphocyte antigen (CD20) ELISA Kit
MBS2803793-01 48 Tests

Rat B-lymphocyte antigen (CD20) ELISA Kit

Sign In for Pricing
View Details
Rat B-lymphocyte antigen (CD20) ELISA Kit
MBS2803793-02 96 Tests

Rat B-lymphocyte antigen (CD20) ELISA Kit

Sign In for Pricing
View Details
Rat B-lymphocyte antigen (CD20) ELISA Kit
MBS2803793-03 5x 96 Tests

Rat B-lymphocyte antigen (CD20) ELISA Kit

Sign In for Pricing
View Details